RABGEF1 antibody

Catalog No. ABIN631729

Product Details anti-RABGEF1 Antibody

Target: RABGEF1 (RAB Guanine Nucleotide Exchange Factor (GEF) 1 (RABGEF1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RABGEF1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: RABGEF1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSLKSERRGIHVDQSDLLCKKGCGYYGNPAWQGFCSKCWREEYHKARQKQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RABGEF1 Blocking Peptide, catalog no. 33R-6460, is also available for use as a blocking control in assays to test for specificity of this RABGEF1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RABGEF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RABGEF1

Target: RABGEF1 (RAB Guanine Nucleotide Exchange Factor (GEF) 1 (RABGEF1))

Alternative Name: RABGEF1 (RABGEF1 Products)

Synonyms: Rab5ef antibody, Rabex5 antibody, Rin2 antibody, RABEX5 antibody, rabex-5 antibody, rabgef1 antibody, RAB guanine nucleotide exchange factor (GEF) 1 antibody, RAB guanine nucleotide exchange factor 1 antibody, RAB guanine nucleotide exchange factor (GEF) 1 L homeolog antibody, Rabgef1 antibody, RABGEF1 antibody, rabgef1.L antibody

Background: RABGEF1 forms a complex with rabaptin-5 that is required for endocytic membrane fusion, and it serves as a specific guanine nucleotide exchange factor (GEF) for RAB5.

Molecular Weight: 57 kDa (MW of target protein)

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process