UPP1 antibody (N-Term)

Catalog No. ABIN631743

Product Details anti-UPP1 Antibody

Target: UPP1 (Uridine Phosphorylase 1 (UPP1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UPP1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: UPP1 antibody was raised against the N terminal of UPP1

Purification: Affinity purified

Immunogen: UPP1 antibody was raised using the N terminal of UPP1 corresponding to a region with amino acids AATGANAEKAESHNDCPVRLLNPNIAKMKEDILYHFNLTTSRHNFPALFG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UPP1 Blocking Peptide, catalog no. 33R-1052, is also available for use as a blocking control in assays to test for specificity of this UPP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UPP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UPP1

Target: UPP1 (Uridine Phosphorylase 1 (UPP1))

Alternative Name: UPP1 (UPP1 Products)

Synonyms: upp1 antibody, UDRPASE antibody, UP antibody, UPASE antibody, UPP antibody, im:6911242 antibody, zgc:110755 antibody, AI325217 antibody, UPase antibody, UdRPase antibody, Up antibody, Upp antibody, uridine phosphorylase 1 antibody, uridine phosphorylase antibody, upp1 antibody, NP_RS08675 antibody, Tsp_02326 antibody, UPP1 antibody, Upp1 antibody

Background: UPP1 catalyzes the reversible phosphorylytic cleavage of uridine and deoxyuridine to uracil and ribose- or deoxyribose-1-phosphate. The produced molecules are then utilized as carbon and energy sources or in the rescue of pyrimidine bases for nucleotide synthesis.

Molecular Weight: 34 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process