TNP1 antibody
-
- Target See all TNP1 Antibodies
- TNP1 (Transition Protein 1 (During Histone To Protamine Replacement) (TNP1))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TNP1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- TNP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSTSRKLKSHGMRRSKSRSPHKGVKRGGSKRKYRKGNLKSRKRGDDANRN
- Top Product
- Discover our top product TNP1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TNP1 Blocking Peptide, catalog no. 33R-6520, is also available for use as a blocking control in assays to test for specificity of this TNP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TNP1 (Transition Protein 1 (During Histone To Protamine Replacement) (TNP1))
- Alternative Name
- TNP1 (TNP1 Products)
- Synonyms
- TNP1 antibody, TP1 antibody, Stp-1 antibody, Tp-1 antibody, STP-1 antibody, TP-1 antibody, transition protein 1 antibody, TNP1 antibody, Tnp1 antibody
- Background
- TNP1 is a spermatid-specific product of the haploid genome which replaces histone and is itself replaced in the mature sperm by the protamines.
- Molecular Weight
- 6 kDa (MW of target protein)
-