FASTKD2 antibody (Middle Region)

Catalog No. ABIN631749

Product Details anti-FASTKD2 Antibody

Target: FASTKD2 (FAST Kinase Domains 2 (FASTKD2))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FASTKD2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FASTKD2 antibody was raised against the middle region of FASTKD2

Purification: Affinity purified

Immunogen: FASTKD2 antibody was raised using the middle region of FASTKD2 corresponding to a region with amino acids DTNRNQVLPLSDVDTTSATDIQRVAVLCVSRSAYCLGSSHPRGFLAMKMR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FASTKD2 Blocking Peptide, catalog no. 33R-2200, is also available for use as a blocking control in assays to test for specificity of this FASTKD2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FASTKD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FASTKD2

Target: FASTKD2 (FAST Kinase Domains 2 (FASTKD2))

Alternative Name: FASTKD2 (FASTKD2 Products)

Synonyms: si:ch211-103i6.5 antibody, KIAA0971 antibody, 2810421I24Rik antibody, RGD1307883 antibody, FAST kinase domains 2 antibody, FASTKD2 antibody, fastkd2 antibody, Fastkd2 antibody

Background: This gene encodes a protein that is localized in the mitochondrial inner compartment and that may play a role in mitochondrial apoptosis. Nonsense mutations have been reported to result in cytochrome c oxidase deficiency.

Molecular Weight: 81 kDa (MW of target protein)