ELP2 antibody

Catalog No. ABIN631751

Product Details anti-ELP2 Antibody

Target: ELP2 (Elongator Acetyltransferase Complex Subunit 2 (ELP2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ELP2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: ELP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EESGVWLEQVRVGEVGGNTLGFYDCQFNEDGSMIIAHAFHGALHLWKQNT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ELP2 Blocking Peptide, catalog no. 33R-2389, is also available for use as a blocking control in assays to test for specificity of this ELP2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ELP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ELP2

Target: ELP2 (Elongator Acetyltransferase Complex Subunit 2 (ELP2))

Alternative Name: ELP2 (ELP2 Products)

Synonyms: zgc:153559 antibody, SHINC-2 antibody, STATIP1 antibody, StIP antibody, AU023723 antibody, Epl2 antibody, StIP1 antibody, Statip1 antibody, F14J22.24 antibody, elongator protein 2 antibody, elongator acetyltransferase complex subunit 2 antibody, elongator protein 2 antibody, elp2 antibody, ELP2 antibody, Elp2 antibody

Background: ELP2 regulates the ligand-dependent activation of STAT3. ELP2 acts as subunit of the RNA polymerase II elongator complex, which is a histone acetyltransferase component of the RNA polymerase II (Pol II) holoenzyme and is involved in transcriptional elongation. Elongator may play a role in chromatin remodeling and is involved in acetylation of histones H3 and probably H4.

Molecular Weight: 92 kDa (MW of target protein)

Pathways: Stem Cell Maintenance, Positive Regulation of Endopeptidase Activity, Protein targeting to Nucleus