Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

ElaC Homolog 1 (E. Coli) (ELAC1) antibody

Antigen

ElaC Homolog 1 (E. Coli) (ELAC1)

Synonyms D29, 2610018O07Rik, 8430417G19Rik, zgc:91956, ELAC1, MGC137913, elac1
Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN631754
Quantity 50 ug  (1 mg/ml)  (Variants)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Alternative name ELAC1
Immunogen ELAC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LFHRIPSFGFSVVEKKRPGKLNAQKLKDLGVPPGPAYGKLKNGISVVLEN
Description ELAC1 belongs to the RNase Z family. It is a zinc phosphodiesterase, which displays some tRNA 3'-processing endonuclease activity. The protein is probably involved in tRNA maturation, by removing a 3'-trailer from precursor tRNA.
Molecular Weight 40 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ELAC1 antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Restrictions For Research Use only

Alternatives

Alternatives for antigen "ElaC Homolog 1 (E. Coli) (ELAC1)", type "Antibodies"
Hosts Mouse (3), Rabbit (3)
Reactivities Human (5)
Applications Western Blotting (WB) (5), ELISA (3), Immunocytochemistry (ICC) (2), Dot Blot (Dot) (1)