VARS antibody (Middle Region)
-
- Target See all VARS Antibodies
- VARS (Valyl-tRNA Synthetase (VARS))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This VARS antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- VARS antibody was raised against the middle region of VARS
- Purification
- Affinity purified
- Immunogen
- VARS antibody was raised using the middle region of VARS corresponding to a region with amino acids AQRLRERRAASGYPVKVPLEVQEADEAKLQQTEAELRKVDEAIALFQKML
- Top Product
- Discover our top product VARS Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
VARS Blocking Peptide, catalog no. 33R-1456, is also available for use as a blocking control in assays to test for specificity of this VARS antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VARS antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- VARS (Valyl-tRNA Synthetase (VARS))
- Alternative Name
- VARS (VARS Products)
- Synonyms
- G7A antibody, VARS1 antibody, VARS2 antibody, VARS antibody, Bat6 antibody, D17H6S56E antibody, G7a antibody, Vars2 antibody, vars1 antibody, vars2 antibody, CHUNP6879 antibody, im:7137378 antibody, wu:fb07a11 antibody, wu:fb07d10 antibody, TrsVal antibody, BEST:LD45671 antibody, CG4062 antibody, Dmel\\CG4062 antibody, VRS antibody, ValRS antibody, l(2)03531 antibody, l(2)rI255 antibody, ld45671 antibody, ECK4251 antibody, JW4215 antibody, val-act antibody, T5E21.11 antibody, T5E21_11 antibody, TWIN 2 antibody, VALRS antibody, VALYL TRNA SYNTHETASE antibody, valyl-tRNA synthetase antibody, Valyl-tRNA synthetase antibody, valyl-tRNA synthetase S homeolog antibody, hypothetical protein antibody, valyl-tRNA synthetase 2, mitochondrial antibody, valyl-tRNA synthetase / valine-tRNA ligase (VALRS) antibody, VARS antibody, Vars antibody, vars antibody, ValRS antibody, vars.S antibody, MW0078 antibody, Pnap_3169 antibody, valS antibody, Fnod_0343 antibody, Cyan7425_1070 antibody, Tola_0553 antibody, Slip_0680 antibody, Astex_3136 antibody, ML5_3395 antibody, VARS2 antibody, TWN2 antibody
- Background
- Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. VARS belongs to class-I aminoacyl-tRNA synthetase family and is located in the class III region of the major histocompatibility complex.
- Molecular Weight
- 140 kDa (MW of target protein)
-