PSAT1 antibody (N-Term)

Catalog No. ABIN631758

Product Details anti-PSAT1 Antibody

Target: PSAT1 (phosphoserine Aminotransferase 1 (PSAT1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PSAT1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: PSAT1 antibody was raised against the N terminal of PSAT1

Purification: Affinity purified

Immunogen: PSAT1 antibody was raised using the N terminal of PSAT1 corresponding to a region with amino acids ADYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTWNLNPDASY

Application Details

Application Notes: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PSAT1 Blocking Peptide, catalog no. 33R-1111, is also available for use as a blocking control in assays to test for specificity of this PSAT1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSAT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PSAT1

Target: PSAT1 (phosphoserine Aminotransferase 1 (PSAT1))

Alternative Name: PSAT1 (PSAT1 Products)

Synonyms: fi15b02 antibody, wu:fi15b02 antibody, zgc:55738 antibody, zgc:77622 antibody, EPIP antibody, PSA antibody, PSAT antibody, D8Ertd814e antibody, Psat antibody, Psa1 antibody, phosphoserine aminotransferase 1 antibody, phosphoserine aminotransferase 1 L homeolog antibody, psat1 antibody, psat1.L antibody, PSAT1 antibody, Psat1 antibody

Background: PSAT1 is likely a phosphoserine aminotransferase, based on similarity to proteins in mouse, rabbit, and Drosophila.

Molecular Weight: 40 kDa (MW of target protein)

Pathways: Warburg Effect