NAPEPLD antibody (N-Term)

Catalog No. ABIN631766

Product Details anti-NAPEPLD Antibody

Target: NAPEPLD (N-Acyl Phosphatidylethanolamine phospholipase D (NAPEPLD))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NAPEPLD antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NAPE-PLD antibody was raised against the N terminal Of Nape-Pld

Purification: Affinity purified

Immunogen: NAPE-PLD antibody was raised using the N terminal Of Nape-Pld corresponding to a region with amino acids TWKNPSIPNVLRWLIMEKDHSSVPSSKEELDKELPVLKPYFITNPEEAGV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NAPE-PLD Blocking Peptide, catalog no. 33R-9379, is also available for use as a blocking control in assays to test for specificity of this NAPE-PLD antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NAPE-PLD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NAPEPLD

Target: NAPEPLD (N-Acyl Phosphatidylethanolamine phospholipase D (NAPEPLD))

Alternative Name: NAPE-PLD (NAPEPLD Products)

Synonyms: FMP30 antibody, NAPE-PLD antibody, A530089G06 antibody, Mbldc1 antibody, N-acyl phosphatidylethanolamine phospholipase D antibody, NAPEPLD antibody, Napepld antibody

Background: NAPE-PLD hydrolyzes N-acyl-phosphatidylethanolamines (NAPEs) to produce N-acylethanolamines (NAEs) and phosphatidic acid. NAPE-PLD is responsible for the generation of anandamide (N-arachidonoylethanolamine).

Molecular Weight: 45 kDa (MW of target protein)