YTHDF3 antibody (N-Term)

Catalog No. ABIN631782

Product Details anti-YTHDF3 Antibody

Target: YTHDF3 (YTH Domain Family, Member 3 (YTHDF3))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This YTHDF3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: YTHDF3 antibody was raised against the N terminal of YTHDF3

Purification: Affinity purified

Immunogen: YTHDF3 antibody was raised using the N terminal of YTHDF3 corresponding to a region with amino acids QPGALGNTPPFLGQHGFNFFPGNADFSTWGTSGSQGQSTQSSAYSSSYGY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

YTHDF3 Blocking Peptide, catalog no. 33R-7676, is also available for use as a blocking control in assays to test for specificity of this YTHDF3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of YTHDF3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for YTHDF3

Target: YTHDF3 (YTH Domain Family, Member 3 (YTHDF3))

Alternative Name: YTHDF3 (YTHDF3 Products)

Synonyms: wu:fi35c09 antibody, zgc:55441 antibody, 9130022A11Rik antibody, YTH N6-methyladenosine RNA binding protein 3 antibody, YTH N(6)-methyladenosine RNA binding protein 3 antibody, YTH domain family 3 antibody, YTH N6-methyladenosine RNA binding protein 3 S homeolog antibody, ythdf3 antibody, YTHDF3 antibody, Ythdf3 antibody, ythdf3.S antibody

Background: YTHDF3 contains 1 YTH domain. The functions of YTHDF3 remain unknown.

Molecular Weight: 64 kDa (MW of target protein)