RSL24D1 antibody (Middle Region)

Catalog No. ABIN631795

Product Details anti-RSL24D1 Antibody

Target: RSL24D1 (Ribosomal L24 Domain Containing 1 (RSL24D1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RSL24D1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C15 ORF15 antibody was raised against the middle region of C15 rf15

Purification: Affinity purified

Immunogen: C15 ORF15 antibody was raised using the middle region of C15 rf15 corresponding to a region with amino acids KCHKNFKKKRNPRKVRWTKAFRKAAGKELTVDNSFEFEKRRNEPIKYQRE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C15ORF15 Blocking Peptide, catalog no. 33R-4271, is also available for use as a blocking control in assays to test for specificity of this C15ORF15 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RSL24D1

Target: RSL24D1 (Ribosomal L24 Domain Containing 1 (RSL24D1))

Alternative Name: C15ORF15 (RSL24D1 Products)

Synonyms: C15orf15 antibody, HRP-L30-iso antibody, L30 antibody, RLP24 antibody, RPL24 antibody, RPL24L antibody, TVAS3 antibody, 2410159K22Rik antibody, RGD1309784 antibody, c15orf15 antibody, wu:fa94f12 antibody, wu:fa95d02 antibody, zgc:56202 antibody, ribosomal L24 domain containing 1 antibody, RSL24D1 antibody, Rsl24d1 antibody, rsl24d1 antibody

Background: This gene encodes a protein sharing a low level of sequence similarity with human ribosomal protein L24. Although this gene has been referred to as RPL24, L30, and 60S ribosomal protein L30 isolog in the sequence databases, it is distinct from the human genes officially named RPL24 (which itself has been referred to as ribosomal protein L30) and RPL30. The function of this gene is currently unknown. This gene utilizes alternative polyadenylation signals.

Molecular Weight: 19 kDa (MW of target protein)