ALDH1B1 antibody (Middle Region)

Catalog No. ABIN631811

Product Details anti-ALDH1B1 Antibody

Target: ALDH1B1 (Aldehyde Dehydrogenase 1 Family, Member B1 (ALDH1B1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ALDH1B1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ALDH1 B1 antibody was raised against the middle region of ALDH1 1

Purification: Affinity purified

Immunogen: ALDH1 B1 antibody was raised using the middle region of ALDH1 1 corresponding to a region with amino acids GFFIKPTVFGGVQDDMRIAKEEIFGPVQPLFKFKKIEEVVERANNTRYGL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ALDH1B1 Blocking Peptide, catalog no. 33R-3255, is also available for use as a blocking control in assays to test for specificity of this ALDH1B1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALDH0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ALDH1B1

Target: ALDH1B1 (Aldehyde Dehydrogenase 1 Family, Member B1 (ALDH1B1))

Alternative Name: ALDH1B1 (ALDH1B1 Products)

Synonyms: ALDH5 antibody, ALDHX antibody, rf2d antibody, 2700007F14Rik antibody, aldehyde dehydrogenase 1 family member B1 antibody, aldehyde dehydrogenase 5 antibody, aldehyde dehydrogenase 1 family, member B1 antibody, aldehyde dehydrogenase 3B1 antibody, hypothetical protein antibody, ALDH1B1 antibody, aldh5 antibody, Aldh1b1 antibody, MCYG_01035 antibody, MGYG_00956 antibody, PGTG_20239 antibody

Background: ALDH1B1 belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. This gene does not contain introns in the coding sequence. The variation of this locus may affect the development of alcohol-related problems.

Molecular Weight: 57 kDa (MW of target protein)