Nop10 antibody (Middle Region)
-
- Target See all Nop10 Antibodies
- Nop10 (NOP10 Ribonucleoprotein Homolog (Nop10))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Nop10 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- NOLA3 antibody was raised against the middle region of Nola3
- Purification
- Affinity purified
- Immunogen
- NOLA3 antibody was raised using the middle region of Nola3 corresponding to a region with amino acids MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKK
- Top Product
- Discover our top product Nop10 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NOLA3 Blocking Peptide, catalog no. 33R-5997, is also available for use as a blocking control in assays to test for specificity of this NOLA3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOLA3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Nop10 (NOP10 Ribonucleoprotein Homolog (Nop10))
- Alternative Name
- NOLA3 (Nop10 Products)
- Synonyms
- DKCB1 antibody, NOLA3 antibody, NOP10P antibody, 1110036B12Rik antibody, Nola3 antibody, nola3 antibody, zgc:109956 antibody, NOP10 ribonucleoprotein antibody, NOP10 ribonucleoprotein homolog (yeast) antibody, NOP10 antibody, Nop10 antibody, nop10 antibody
- Background
- This gene is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been classified into two families: C/D and H/ACA.
- Molecular Weight
- 8 kDa (MW of target protein)
-