WDR55 antibody (Middle Region)

Catalog No. ABIN631883

Product Details anti-WDR55 Antibody

Target: WDR55 (WD Repeat Domain 55 (WDR55))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This WDR55 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: WDR55 antibody was raised against the middle region of WDR55

Purification: Affinity purified

Immunogen: WDR55 antibody was raised using the middle region of WDR55 corresponding to a region with amino acids AKKLLLTASGDGCLGIFNIKRRRFELLSEPQSGDLTSVTLMKWGKKVACG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

WDR55 Blocking Peptide, catalog no. 33R-1298, is also available for use as a blocking control in assays to test for specificity of this WDR55 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR55 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for WDR55

Target: WDR55 (WD Repeat Domain 55 (WDR55))

Alternative Name: WDR55 (WDR55 Products)

Synonyms: MGC146726 antibody, 2410080P20Rik antibody, C80692 antibody, LRRG00133 antibody, RGD1305640 antibody, flj20195l antibody, zgc:111796 antibody, WD repeat domain 55 antibody, WDR55 antibody, wdr55 antibody, Wdr55 antibody

Background: WDR55 is a nucleolar protein that acts as a modulator of rRNA synthesis. WDR55 plays a central role during organogenesis.

Molecular Weight: 42 kDa (MW of target protein)