MMD2 antibody (N-Term)
-
- Target See all MMD2 Antibodies
- MMD2 (Monocyte To Macrophage Differentiation-Associated 2 (MMD2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MMD2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MMD2 antibody was raised against the N terminal of MMD2
- Purification
- Affinity purified
- Immunogen
- MMD2 antibody was raised using the N terminal of MMD2 corresponding to a region with amino acids FAPRLLDFQKTKYARFMNHRVPAHKRYQPTEYEHAANCATHAFWIIPSIL
- Top Product
- Discover our top product MMD2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MMD2 Blocking Peptide, catalog no. 33R-2846, is also available for use as a blocking control in assays to test for specificity of this MMD2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MMD2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MMD2 (Monocyte To Macrophage Differentiation-Associated 2 (MMD2))
- Alternative Name
- MMD2 (MMD2 Products)
- Synonyms
- PAQR10 antibody, 4930518M15Rik antibody, C88001 antibody, mmd2 antibody, paqr10 antibody, si:dkey-21n8.8 antibody, monocyte to macrophage differentiation associated 2 antibody, monocyte to macrophage differentiation-associated 2 antibody, monocyte to macrophage differentiation-associated 2a antibody, MMD2 antibody, Mmd2 antibody, mmd2a antibody
- Background
- MMD2 contains 1 COMM domain. The exact function of MMD2 remains unknown.
- Molecular Weight
- 31 kDa (MW of target protein)
-