FUNDC1 antibody (Middle Region)

Catalog No. ABIN631937

Product Details anti-FUNDC1 Antibody

Target: FUNDC1 (FUN14 Domain Containing 1 (FUNDC1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FUNDC1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FUNDC1 antibody was raised against the middle region of FUNDC1

Purification: Affinity purified

Immunogen: FUNDC1 antibody was raised using the middle region of FUNDC1 corresponding to a region with amino acids TAVGGGFLLLQIASHSGYVQIDWKRVEKDVNKAKRQIKKRANKAAPEINN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FUNDC1 Blocking Peptide, catalog no. 33R-8988, is also available for use as a blocking control in assays to test for specificity of this FUNDC1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FUNDC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FUNDC1

Target: FUNDC1 (FUN14 Domain Containing 1 (FUNDC1))

Alternative Name: FUNDC1 (FUNDC1 Products)

Synonyms: fundc1-a antibody, 1500005J14Rik antibody, 1810033P05Rik antibody, zgc:92600 antibody, FUN14 domain-containing protein 1-like antibody, FUN14 domain containing 1 S homeolog antibody, FUN14 domain containing 1 antibody, LOC100357289 antibody, fundc1.S antibody, FUNDC1 antibody, Fundc1 antibody, fundc1 antibody

Background: FUNDC1 belongs to the FUN14 family. The exact function of FUNDC1 remains unknown.

Molecular Weight: 17 kDa (MW of target protein)