FBP2 antibody (Middle Region)

Catalog No. ABIN631953

Product Details anti-FBP2 Antibody

Target: FBP2 (Fructose-1,6-Bisphosphatase 2 (FBP2))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FBP2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FBP2 antibody was raised against the middle region of FBP2

Purification: Affinity purified

Immunogen: FBP2 antibody was raised using the middle region of FBP2 corresponding to a region with amino acids YIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FBP2 Blocking Peptide, catalog no. 33R-10138, is also available for use as a blocking control in assays to test for specificity of this FBP2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FBP2

Target: FBP2 (Fructose-1,6-Bisphosphatase 2 (FBP2))

Alternative Name: FBP2 (FBP2 Products)

Synonyms: 6330409F21Rik antibody, Fbp2 antibody, Fubp2 antibody, Ksrp antibody, Fbp-1 antibody, Fbp1 antibody, Rae-30 antibody, FBPase antibody, zgc:101083 antibody, FBP2 antibody, MGC108013 antibody, FBP antibody, fructose-bisphosphatase 2 antibody, KH-type splicing regulatory protein antibody, fructose bisphosphatase 2 antibody, fructose-1,6-bisphosphatase 2 antibody, fructose-bisphosphatase 2 L homeolog antibody, FBP2 antibody, Khsrp antibody, Fbp2 antibody, fbp2 antibody, fbp2.L antibody

Background: FBP2 is a gluconeogenesis regulatory enzyme which catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate.

Molecular Weight: 37 kDa (MW of target protein)