NOB1 antibody

Catalog No. ABIN631975

Product Details anti-NOB1 Antibody

Target: NOB1 (RNA-Binding Protein NOB1 (NOB1))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NOB1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: NOB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LPTPKGGKYAINPHLTEDQRFPQLRLSQKARQKTNVFAPDYIAGVSPFVE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NOB1 Blocking Peptide, catalog no. 33R-5294, is also available for use as a blocking control in assays to test for specificity of this NOB1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NOB1

Target: NOB1 (RNA-Binding Protein NOB1 (NOB1))

Alternative Name: NOB1 (NOB1 Products)

Synonyms: MEE6.26 antibody, MEE6_26 antibody, Nob1p antibody, fc27e05 antibody, si:ch73-167i17.3 antibody, wu:fc27e05 antibody, ART-4 antibody, MST158 antibody, NOB1P antibody, PSMD8BP1 antibody, 1700021I09Rik antibody, Psmd8bp1 antibody, NIN1/PSMD8 binding protein 1 homolog antibody, RNA-binding NOB1-like protein antibody, RNA-binding protein nob1 antibody, RNA-binding protein NOB1 antibody, NIN1/RPN12 binding protein 1 homolog S homeolog antibody, NIN1/RPN12 binding protein 1 homolog (S. cerevisiae) antibody, NIN1/RPN12 binding protein 1 homolog antibody, NOB1 antibody, AT5G41190 antibody, EDI_130960 antibody, CpipJ_CPIJ012739 antibody, BDBG_01281 antibody, PAAG_04204 antibody, PITG_13300 antibody, nob1.S antibody, nob1 antibody, Nob1 antibody

Background: NOB1 may play a role in mRNA degradation.

Molecular Weight: 47 kDa (MW of target protein)

Pathways: Protein targeting to Nucleus