SPAG6 antibody (Middle Region)

Catalog No. ABIN631997

Product Details anti-SPAG6 Antibody

Target: SPAG6 (Sperm Associated Antigen 6 (SPAG6))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SPAG6 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SPAG6 antibody was raised against the middle region of SPAG6

Purification: Affinity purified

Immunogen: SPAG6 antibody was raised using the middle region of SPAG6 corresponding to a region with amino acids HVVGQFSKVLPHDSKARRLFVTSGGLKKVQEIKAEPGSLLQEYINSINSC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SPAG6 Blocking Peptide, catalog no. 33R-3872, is also available for use as a blocking control in assays to test for specificity of this SPAG6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPAG6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SPAG6

Target: SPAG6 (Sperm Associated Antigen 6 (SPAG6))

Alternative Name: SPAG6 (SPAG6 Products)

Synonyms: Repro-SA-1 antibody, pf16 antibody, PF16 antibody, RGD1310892 antibody, zgc:91805 antibody, SPAG6 antibody, repro-sa-1 antibody, DKFZp459D035 antibody, sperm associated antigen 6 antibody, sperm associated antigen 6-like antibody, sperm associated antigen 6 L homeolog antibody, SPAG6 antibody, Spag6l antibody, Spag6 antibody, spag6 antibody, spag6.L antibody

Background: SPAG6 is important for structural integrity of the central apparatus in the sperm tail and for flagellar motility.

Molecular Weight: 56 kDa (MW of target protein)