RTDR1 antibody (N-Term)

Catalog No. ABIN632006

Product Details anti-RTDR1 Antibody

Target: RTDR1 (Rhabdoid Tumor Deletion Region Gene 1 (RTDR1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RTDR1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RTDR1 antibody was raised against the N terminal of RTDR1

Purification: Affinity purified

Immunogen: RTDR1 antibody was raised using the N terminal of RTDR1 corresponding to a region with amino acids MAHSQNSLELPININATQITTAYGHRALPKLKEELQSEDLQTRQKALMAL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RTDR1 Blocking Peptide, catalog no. 33R-5675, is also available for use as a blocking control in assays to test for specificity of this RTDR1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RTDR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RTDR1

Target: RTDR1 (Rhabdoid Tumor Deletion Region Gene 1 (RTDR1))

Alternative Name: RTDR1 (RTDR1 Products)

Synonyms: 4933431K05Rik antibody, si:dkey-220o5.4 antibody, radial spoke head 14 homolog antibody, rtdr1, putative antibody, radial spoke head homolog 14 (Chlamydomonas) antibody, radial spoke head 14 homolog (Chlamydomonas) antibody, RSPH14 antibody, Smp_151730 antibody, Rsph14 antibody, rsph14 antibody

Background: The function of RTDR1 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 38 kDa (MW of target protein)