ASPRV1 antibody (Middle Region)

Catalog No. ABIN632022

Product Details anti-ASPRV1 Antibody

Target: ASPRV1 (Aspartic Peptidase, Retroviral-Like 1 (ASPRV1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ASPRV1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SASP antibody was raised against the middle region of Sasp

Purification: Affinity purified

Immunogen: SASP antibody was raised using the middle region of Sasp corresponding to a region with amino acids RGEALGVYNRLSPQDQGDYGTVKEALLKAFGVPGAAPSHLPKEIVFANSM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SASP Blocking Peptide, catalog no. 33R-7921, is also available for use as a blocking control in assays to test for specificity of this SASP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SASP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ASPRV1

Target: ASPRV1 (Aspartic Peptidase, Retroviral-Like 1 (ASPRV1))

Alternative Name: SASP (ASPRV1 Products)

Synonyms: MUNO antibody, SASP antibody, SASPase antibody, Taps antibody, 2300003P22Rik antibody, AA986851 antibody, RGD1560859 antibody, aspartic peptidase retroviral like 1 antibody, aspartic peptidase, retroviral-like 1 antibody, ASPRV1 antibody, Asprv1 antibody

Background: The specific function of SASP is not yet known.

Molecular Weight: 37 kDa (MW of target protein)

Pathways: Carbohydrate Homeostasis, Cell RedoxHomeostasis