STK16 antibody (Middle Region)

Catalog No. ABIN632056

Product Details anti-STK16 Antibody

Target: STK16 (serine/threonine Kinase 16 (STK16))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This STK16 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: STK16 antibody was raised against the middle region of STK16

Purification: Affinity purified

Immunogen: STK16 antibody was raised using the middle region of STK16 corresponding to a region with amino acids TDVWSLGCVLYAMMFGEGPYDMVFQKGDSVALAVQNQLSIPQSPRHSSAL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

STK16 Blocking Peptide, catalog no. 33R-9027, is also available for use as a blocking control in assays to test for specificity of this STK16 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STK16 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for STK16

Target: STK16 (serine/threonine Kinase 16 (STK16))

Alternative Name: STK16 (STK16 Products)

Synonyms: stk16 antibody, STK16 antibody, Stk16 antibody, ACYPI000353 antibody, KRCT antibody, MPSK antibody, PKL12 antibody, TSF1 antibody, EDPK antibody, Krct antibody, TSF-1 antibody, F52 antibody, serine/threonine kinase 16 antibody, serine/threonine kinase 16 L homeolog antibody, serine/threonine-protein kinase antibody, STK16 antibody, stk16.L antibody, stk16 antibody, Stk16 antibody

Background: STK16 is a protein kinase that acts on both serine and threonine residues.

Molecular Weight: 35 kDa (MW of target protein)