EML1 antibody (C-Term)

Catalog No. ABIN632123

Product Details anti-EML1 Antibody

Target: EML1 (Echinoderm Microtubule Associated Protein Like 1 (EML1))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EML1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: EML1 antibody was raised against the C terminal of EML1

Purification: Affinity purified

Immunogen: EML1 antibody was raised using the C terminal of EML1 corresponding to a region with amino acids YPCSQFRAPSHIYGGHSSHVTNVDFLCEDSHLISTGGKDTSIMQWRVI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EML1 Blocking Peptide, catalog no. 33R-10195, is also available for use as a blocking control in assays to test for specificity of this EML1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EML1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EML1

Target: EML1 (Echinoderm Microtubule Associated Protein Like 1 (EML1))

Alternative Name: EML1 (EML1 Products)

Synonyms: ELP79 antibody, EMAP antibody, EMAPL antibody, HuEMAP antibody, EML1 antibody, MGC108311 antibody, wu:fj01a06 antibody, zgc:153105 antibody, 1110008N23Rik antibody, A930030P13Rik antibody, AA171013 antibody, AI847476 antibody, AI853955 antibody, echinoderm microtubule associated protein like 1 antibody, echinoderm microtubule associated protein like 1 S homeolog antibody, EML1 antibody, eml1.S antibody, eml1 antibody, Eml1 antibody

Background: Human echinoderm microtubule-associated protein-like is a strong candidate for the Usher syndrome type 1A gene. Usher syndromes (USHs) are a group of genetic disorders consisting of congenital deafness, retinitis pigmentosa, and vestibular dysfunction of variable onset and severity depending on the genetic type.

Molecular Weight: 92 kDa (MW of target protein)