RTDR1 antibody (Middle Region)
-
- Target See all RTDR1 Antibodies
- RTDR1 (Rhabdoid Tumor Deletion Region Gene 1 (RTDR1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RTDR1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RTDR1 antibody was raised against the middle region of RTDR1
- Purification
- Affinity purified
- Immunogen
- RTDR1 antibody was raised using the middle region of RTDR1 corresponding to a region with amino acids IARLNATKALTMLAEAPEGRKALQTHVPTFRAMEVETYEKPQVAEALQRA
- Top Product
- Discover our top product RTDR1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RTDR1 Blocking Peptide, catalog no. 33R-3896, is also available for use as a blocking control in assays to test for specificity of this RTDR1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RTDR1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RTDR1 (Rhabdoid Tumor Deletion Region Gene 1 (RTDR1))
- Alternative Name
- RTDR1 (RTDR1 Products)
- Background
- This gene encodes a protein with no known function but with slight similarity to a yeast vacuolar protein. The gene is located in a region deleted in pediatric rhabdoid tumors of the brain, kidney and soft tissues, but mutations in this gene have not been associated with the disease.
- Molecular Weight
- 38 kDa (MW of target protein)
-