RTDR1 antibody (Middle Region)

Catalog No. ABIN632124

Product Details anti-RTDR1 Antibody

Target: RTDR1 (Rhabdoid Tumor Deletion Region Gene 1 (RTDR1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RTDR1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RTDR1 antibody was raised against the middle region of RTDR1

Purification: Affinity purified

Immunogen: RTDR1 antibody was raised using the middle region of RTDR1 corresponding to a region with amino acids IARLNATKALTMLAEAPEGRKALQTHVPTFRAMEVETYEKPQVAEALQRA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RTDR1 Blocking Peptide, catalog no. 33R-3896, is also available for use as a blocking control in assays to test for specificity of this RTDR1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RTDR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RTDR1

Target: RTDR1 (Rhabdoid Tumor Deletion Region Gene 1 (RTDR1))

Alternative Name: RTDR1 (RTDR1 Products)

Background: This gene encodes a protein with no known function but with slight similarity to a yeast vacuolar protein. The gene is located in a region deleted in pediatric rhabdoid tumors of the brain, kidney and soft tissues, but mutations in this gene have not been associated with the disease.

Molecular Weight: 38 kDa (MW of target protein)