MAGEA6 antibody (Middle Region)

Catalog No. ABIN632131

Product Details anti-MAGEA6 Antibody

Target: MAGEA6 (Melanoma Antigen Family A, 6 (MAGEA6))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MAGEA6 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MAGEA6 antibody was raised against the middle region of MAGEA6

Purification: Affinity purified

Immunogen: MAGEA6 antibody was raised using the middle region of MAGEA6 corresponding to a region with amino acids APEEKIWEELSVLEVFEGREDSIFGDPKKLLTQYFVQENYLEYRQVPGSD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MAGEA6 Blocking Peptide, catalog no. 33R-1419, is also available for use as a blocking control in assays to test for specificity of this MAGEA6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAGEA6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MAGEA6

Target: MAGEA6 (Melanoma Antigen Family A, 6 (MAGEA6))

Alternative Name: MAGEA6 (MAGEA6 Products)

Synonyms: Mage-a6 antibody, CT1.6 antibody, MAGE-3b antibody, MAGE3B antibody, MAGE6 antibody, melanoma antigen, family A, 6 antibody, MAGE family member A6 antibody, Magea6 antibody, MAGEA6 antibody

Background: MAGEA6 gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls.

Molecular Weight: 35 kDa (MW of target protein)