AP3M2 antibody (Middle Region)

Catalog No. ABIN632155

Product Details anti-AP3M2 Antibody

Target: AP3M2 (Adaptor-Related Protein Complex 3, mu 2 Subunit (AP3M2))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AP3M2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: AP3 M2 antibody was raised against the middle region of AP3 2

Purification: Affinity purified

Immunogen: AP3 M2 antibody was raised using the middle region of AP3 2 corresponding to a region with amino acids VVNTITGSTNVGDQLPTGQLSVVPWRRTGVKYTNNEAYFDVIEEIDAIID

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AP3M2 Blocking Peptide, catalog no. 33R-9888, is also available for use as a blocking control in assays to test for specificity of this AP3M2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AP0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AP3M2

Target: AP3M2 (Adaptor-Related Protein Complex 3, mu 2 Subunit (AP3M2))

Alternative Name: AP3M2 (AP3M2 Products)

Synonyms: wu:fc15g12 antibody, zgc:86670 antibody, AP47B antibody, CLA20 antibody, P47B antibody, 5830445E16Rik antibody, AP-3B antibody, adaptor related protein complex 3 mu 2 subunit antibody, AP-3 complex subunit mu-2 antibody, adaptor-related protein complex 3, mu 2 subunit antibody, adaptor related protein complex 3 mu 2 subunit S homeolog antibody, AP3M2 antibody, ap3m2 antibody, LOC582979 antibody, ap3m2.S antibody, Ap3m2 antibody

Background: AP3M2 is part of the AP-3 complex, an adaptor-related complex which is not clathrin-associated. The complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes.

Molecular Weight: 47 kDa (MW of target protein)