TADA1 antibody

Catalog No. ABIN632160

Product Details anti-TADA1 Antibody

Target: TADA1 (Transcriptional Adaptor 1 (TADA1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TADA1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: TADA1 L antibody was raised using a synthetic peptide corresponding to a region with amino acids REVIPTHTVYALNIERIITKLWHPNHEELQQDKVHRQRLAAKEGLLLC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TADA1L Blocking Peptide, catalog no. 33R-7893, is also available for use as a blocking control in assays to test for specificity of this TADA1L antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TADA0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TADA1

Target: TADA1 (Transcriptional Adaptor 1 (TADA1))

Alternative Name: TADA1L (TADA1 Products)

Synonyms: tada1l antibody, MGC89522 antibody, TADA1L antibody, DKFZp459M089 antibody, STAF42 antibody, zgc:85851 antibody, ADA1 antibody, HFI1 antibody, RP1-9E21.4 antibody, hADA1 antibody, 2900026B15Rik antibody, D1Ertd251e antibody, Staf42 antibody, Tada1l antibody, RGD1306774 antibody, TADA1 antibody, transcriptional adaptor 1 antibody, transcriptional adaptor 1 L homeolog antibody, tada1 antibody, TADA1 antibody, tada1.L antibody, Tada1 antibody

Background: TADA1L belongs to the TADA1L family.It is probably involved in transcriptional regulation.

Molecular Weight: 37 kDa (MW of target protein)