EPB42 antibody (Middle Region)

Catalog No. ABIN632184

Product Details anti-EPB42 Antibody

Target: EPB42 (erythrocyte Membrane Protein Band 4.2 (EPB42))

Binding Specificity: Middle Region

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EPB42 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: EPB42 antibody was raised against the middle region of EPB42

Purification: Affinity purified

Immunogen: EPB42 antibody was raised using the middle region of EPB42 corresponding to a region with amino acids ISTKGVGSDRCEDITQNYKYPEGSLQEKEVLERVEKEKMEREKDNGIRPP

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EPB42 Blocking Peptide, catalog no. 33R-4166, is also available for use as a blocking control in assays to test for specificity of this EPB42 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EPB42 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EPB42

Target: EPB42 (erythrocyte Membrane Protein Band 4.2 (EPB42))

Alternative Name: EPB42 (EPB42 Products)

Synonyms: PA antibody, SPH5 antibody, Epb4.2 antibody, Epb42 antibody, erythrocyte membrane protein band 4.2 antibody, EPB42 antibody, Epb42 antibody

Background: Erythrocyte membrane protein band 4.2 is an ATP-binding protein which may regulate the association of protein 3 with ankyrin. It probably has a role in erythrocyte shape and mechanical property regulation. Mutations in the EPB42 gene are associated with recessive spherocytic elliptocytosis and recessively transmitted hereditary hemolytic anemia.

Molecular Weight: 80 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis