INSL5 antibody (Middle Region)

Catalog No. ABIN632233

Product Details anti-INSL5 Antibody

Target: INSL5 (Insulin-Like 5 (INSL5))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This INSL5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: INSL5 antibody was raised against the middle region of INSL5

Purification: Affinity purified

Immunogen: INSL5 antibody was raised using the middle region of INSL5 corresponding to a region with amino acids RTVIYICASSRWRRHQEGIPQAQQAETGNSFQLPHKREFSEENPAQNLPK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

INSL5 Blocking Peptide, catalog no. 33R-8237, is also available for use as a blocking control in assays to test for specificity of this INSL5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of INSL5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for INSL5

Target: INSL5 (Insulin-Like 5 (INSL5))

Alternative Name: INSL5 (INSL5 Products)

Synonyms: PRO182 antibody, UNQ156 antibody, RIF2 antibody, insulin like 5 antibody, insulin-like 5 antibody, INSL5 antibody, Insl5 antibody

Background: The protein encoded by this gene contains a classical signature of the insulin superfamily and is highly similar to relaxin 3 (RLN3/INSL7).

Molecular Weight: 13 kDa (MW of target protein)

Pathways: Hormone Activity