TPRN antibody (Middle Region)

Catalog No. ABIN632260

Product Details anti-TPRN Antibody

Target: TPRN (Taperin (TPRN))

Binding Specificity: Middle Region

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TPRN antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C9 ORF75 antibody was raised against the middle region of C9 rf75

Purification: Affinity purified

Immunogen: C9 ORF75 antibody was raised using the middle region of C9 rf75 corresponding to a region with amino acids PPFLPAASEEAEPAEGLRVPGLAKNSREYVRPGLPVTFIDEVDSEEAPQA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C9ORF75 Blocking Peptide, catalog no. 33R-7251, is also available for use as a blocking control in assays to test for specificity of this C9ORF75 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF75 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TPRN

Target: TPRN (Taperin (TPRN))

Alternative Name: C9ORF75 (TPRN Products)

Background: The specific function of C9orf75 is not yet known.

Molecular Weight: 72 kDa (MW of target protein)

Pathways: Sensory Perception of Sound