LCA5 antibody (N-Term)

Catalog No. ABIN632308

Product Details anti-LCA5 Antibody

Target: LCA5 (Leber Congenital Amaurosis 5 (LCA5))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LCA5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LCA5 antibody was raised against the N terminal of LCA5

Purification: Affinity purified

Immunogen: LCA5 antibody was raised using the N terminal of LCA5 corresponding to a region with amino acids FSLQKLKEISEARHLPERDDLAKKLVSAELKLDDTERRIKELSKNLELST

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LCA5 Blocking Peptide, catalog no. 33R-3071, is also available for use as a blocking control in assays to test for specificity of this LCA5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LCA5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LCA5

Target: LCA5 (Leber Congenital Amaurosis 5 (LCA5))

Alternative Name: LCA5 (LCA5 Products)

Synonyms: C6orf152 antibody, RGD1308555 antibody, 4930431B11Rik antibody, 5730406O13Rik antibody, AV274874 antibody, ORF64 antibody, LCA5, lebercilin antibody, Leber congenital amaurosis 5 antibody, Leber congenital amaurosis 5 (human) antibody, LCA5 antibody, LOC787523 antibody, Lca5 antibody

Background: LCA5 is a protein that is thought to be involved in centrosomal or ciliary functions. Mutations in this gene cause Leber congenital amaurosis type V. Mutations in this gene cause Leber congenital amaurosis type V. Alternative splicing results in two transcript variants.

Molecular Weight: 80 kDa (MW of target protein)