ASB7 antibody (Middle Region)

Catalog No. ABIN632314

Product Details anti-ASB7 Antibody

Target: ASB7 (Ankyrin Repeat and SOCS Box Containing 7 (ASB7))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ASB7 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ASB7 antibody was raised against the middle region of ASB7

Purification: Affinity purified

Immunogen: ASB7 antibody was raised using the middle region of ASB7 corresponding to a region with amino acids QTPLHLSALRDDVLCARMLYNYGADTNTRNYEGQTPLAVSISISGSSRPC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ASB7 Blocking Peptide, catalog no. 33R-7760, is also available for use as a blocking control in assays to test for specificity of this ASB7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASB7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ASB7

Target: ASB7 (Ankyrin Repeat and SOCS Box Containing 7 (ASB7))

Alternative Name: ASB7 (ASB7 Products)

Synonyms: AI449039 antibody, Asb-7 antibody, D030055C23Rik antibody, asb7 antibody, zgc:77381 antibody, ASB-7 antibody, ankyrin repeat and SOCS box containing 7 antibody, ankyrin repeat and SOCS box-containing 7 antibody, ankyrin repeat and SOCS box containing 7 L homeolog antibody, ASB7 antibody, Asb7 antibody, asb7.L antibody, asb7 antibody

Background: The protein encoded by this gene belongs to a family of ankyrin repeat proteins that, along with four other protein families, contains a C-terminal SOCS box motif. Growing evidence suggests that the SOCS box acts as a bridge between specific substrate-binding domains and the more generic proteins that comprise a large family of E3 ubiquitin protein ligases. In this way, SOCS box containing proteins may regulate protein turnover by targeting proteins for polyubiquination and, therefore, for proteasome-mediated degradation. Two alternative transcripts encoding different isoforms have been described.

Molecular Weight: 36 kDa (MW of target protein)