CTF18 antibody

Catalog No. ABIN632332

Product Details anti-CTF18 Antibody

Target: CTF18 (CHTF18) (CTF18, Chromosome Transmission Fidelity Factor 18 Homolog (CHTF18))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CTF18 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: CHTF18 antibody was raised using a synthetic peptide corresponding to a region with amino acids SLVGTMLAYSLTYRQERTPDGQYIYRLEPNVEELCRFPELPARKPLTYQT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CHTF18 Blocking Peptide, catalog no. 33R-8631, is also available for use as a blocking control in assays to test for specificity of this CHTF18 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHTF18 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CTF18

Target: CTF18 (CHTF18) (CTF18, Chromosome Transmission Fidelity Factor 18 Homolog (CHTF18))

Alternative Name: CHTF18 (CHTF18 Products)

Synonyms: CHTF18 antibody, zgc:113153 antibody, MGC81266 antibody, 6030457M03Rik antibody, CTF18 antibody, Chl12 antibody, C16orf41 antibody, C321D2.2 antibody, C321D2.3 antibody, C321D2.4 antibody, CHL12 antibody, Ctf18 antibody, RUVBL antibody, chromosome transmission fidelity factor 18 antibody, CTF18, chromosome transmission fidelity factor 18 homolog (S. cerevisiae) antibody, chromosome transmission fidelity factor 18 L homeolog antibody, chromosome transmission fidelity protein 18 homolog antibody, CTF18, chromosome transmission fidelity factor 18 antibody, Chtf18 antibody, CHTF18 antibody, chtf18 antibody, chtf18.L antibody, LOC726742 antibody, LOC100160476 antibody, LOC100433034 antibody, LOC100442428 antibody, LOC100632105 antibody, LOC100642927 antibody

Background: CHTF18, CHTF8, and DCC1 are components of an alternative replication factor C (RFC) complex that loads PCNA onto DNA during S phase of the cell cycle.

Molecular Weight: 107 kDa (MW of target protein)