FBXL16 antibody (Middle Region)

Catalog No. ABIN632354

Product Details anti-FBXL16 Antibody

Target: FBXL16 (F-Box and Leucine-Rich Repeat Protein 16 (FBXL16))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FBXL16 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FBXL16 antibody was raised against the middle region of FBXL16

Purification: Affinity purified

Immunogen: FBXL16 antibody was raised using the middle region of FBXL16 corresponding to a region with amino acids GCPLLTTTGLSGLVQLQELEELELTNCPGATPELFKYFSQHLPRCLVIE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FBXL16 Blocking Peptide, catalog no. 33R-3191, is also available for use as a blocking control in assays to test for specificity of this FBXL16 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXL16 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FBXL16

Target: FBXL16 (F-Box and Leucine-Rich Repeat Protein 16 (FBXL16))

Alternative Name: FBXL16 (FBXL16 Products)

Synonyms: C16orf22 antibody, Fbl16 antibody, c380A1.1 antibody, BC042620 antibody, Scirr1 antibody, VIER F-box proteine 2 antibody, F-box and leucine rich repeat protein 16 antibody, fbxl16, putative antibody, F-box and leucine-rich repeat protein 16 antibody, VIER F-box protein 2 antibody, FBXL16 antibody, Smp_174380 antibody, fbxl16 antibody, Fbxl16 antibody, VFB2 antibody

Background: FBXL16 is a substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.Members of the F-box protein family, such as FBXL16, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases.

Molecular Weight: 52 kDa (MW of target protein)