FBXO36 antibody (N-Term)

Catalog No. ABIN632357

Product Details anti-FBXO36 Antibody

Target: FBXO36 (F-Box Protein 36 (FBXO36))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FBXO36 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FBXO36 antibody was raised against the N terminal of FBXO36

Purification: Affinity purified

Immunogen: FBXO36 antibody was raised using the N terminal of FBXO36 corresponding to a region with amino acids QVIFRWWKISLRSEYRSTKPGEAKETHEDFLENSHLQGQTALIFGARILD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FBXO36 Blocking Peptide, catalog no. 33R-7774, is also available for use as a blocking control in assays to test for specificity of this FBXO36 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO36 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FBXO36

Target: FBXO36 (F-Box Protein 36 (FBXO36))

Alternative Name: FBXO36 (FBXO36 Products)

Synonyms: Fbx36 antibody, 0610008D19Rik antibody, 1110020F21Rik antibody, 2410002G19Rik antibody, D1Ertd757e antibody, MGC69236 antibody, FBXO36 antibody, fbxo36 antibody, zgc:153743 antibody, DKFZp469N2119 antibody, zgc:153717 antibody, F-box protein 36 antibody, F-box protein 36b antibody, F-box protein 36a antibody, FBXO36 antibody, Fbxo36 antibody, fbxo36 antibody, fbxo36b antibody, fbxo36a antibody

Background: Members of the F-box protein family, such as FBXO36, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.

Molecular Weight: 22 kDa (MW of target protein)