UFL1 antibody (Middle Region)

Catalog No. ABIN632366

Product Details anti-UFL1 Antibody

Target: UFL1 (UFM1-Specific Ligase 1 (UFL1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UFL1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KIAA0776 antibody was raised against the middle region of KIAA0776

Purification: Affinity purified

Immunogen: KIAA0776 antibody was raised using the middle region of KIAA0776 corresponding to a region with amino acids EYLIKPLNKTYLEVVRSVFMSSTTSASGTGRKRTIKDLQEEVSNLYNNIR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KIAA0776 Blocking Peptide, catalog no. 33R-2824, is also available for use as a blocking control in assays to test for specificity of this KIAA0776 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA0776 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UFL1

Target: UFL1 (UFM1-Specific Ligase 1 (UFL1))

Alternative Name: KIAA0776 (UFL1 Products)

Synonyms: 1810074P20Rik antibody, AI429228 antibody, Kiaa0776 antibody, Maxer antibody, Rcad antibody, mKIAA0776 antibody, KIAA0776 antibody, NLBP antibody, RCAD antibody, RP3-393D12.1 antibody, RGD1309308 antibody, zgc:63562 antibody, UFM1 specific ligase 1 antibody, Ufm1-specific ligase 1 antibody, UFM1-specific ligase 1 antibody, Ufl1 antibody, UFL1 antibody, ufl1 antibody

Background: KIAA0776 is an E3 UFM1-protein ligase that mediates ufmylation of target proteins such as DDRGK1/C20orf116. The function of ufmylation is unknown.

Molecular Weight: 89 kDa (MW of target protein)