FBXO33 antibody (Middle Region)

Catalog No. ABIN632372

Product Details anti-FBXO33 Antibody

Target: FBXO33 (F-Box Protein 33 (FBXO33))

Binding Specificity: Middle Region

Reactivity: Rat, Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FBXO33 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FBXO33 antibody was raised against the middle region of FBXO33

Purification: Affinity purified

Immunogen: FBXO33 antibody was raised using the middle region of FBXO33 corresponding to a region with amino acids VIDTSGFPDLSDNRNEDPLVLLAWRCTKLSLLAIHGYTVWAHNLIAIARL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FBXO33 Blocking Peptide, catalog no. 33R-9590, is also available for use as a blocking control in assays to test for specificity of this FBXO33 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO33 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FBXO33

Target: FBXO33 (F-Box Protein 33 (FBXO33))

Alternative Name: FBXO33 (FBXO33 Products)

Synonyms: FBXO33 antibody, BMND12 antibody, Fbx33 antibody, c14_5247 antibody, 5730501N20Rik antibody, AI642135 antibody, F-box protein 33 antibody, F-box protein 33 S homeolog antibody, FBXO33 antibody, fbxo33 antibody, fbxo33.S antibody, Fbxo33 antibody

Background: FBXO33 is the substrate recognition component of a (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. FBXO33 probably recognises and binds to phosphorylated target proteins. recognises YBX1.

Molecular Weight: 62 kDa (MW of target protein)