HAUS7 antibody (Middle Region)

Catalog No. ABIN632374

Product Details anti-HAUS7 Antibody

Target: HAUS7 (HAUS Augmin-Like Complex, Subunit 7 (HAUS7))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HAUS7 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: UCHL5 IP antibody was raised against the middle region of UCHL5 P

Purification: Affinity purified

Immunogen: UCHL5 IP antibody was raised using the middle region of UCHL5 P corresponding to a region with amino acids LLDTIRSLTIGCSSCSSLMEHFEDTREKNEALLGELFSSPHLQMLLNPEC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UCHL5IP Blocking Peptide, catalog no. 33R-5125, is also available for use as a blocking control in assays to test for specificity of this UCHL5IP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UCHL0 P antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HAUS7

Target: HAUS7 (HAUS Augmin-Like Complex, Subunit 7 (HAUS7))

Alternative Name: UCHL5IP (HAUS7 Products)

Synonyms: UCHL5IP antibody, UIP1 antibody, 1110020L19Rik antibody, Uchl5ip antibody, Uip1 antibody, RGD1562991 antibody, HAUS augmin like complex subunit 7 antibody, HAUS augmin-like complex, subunit 7 antibody, HAUS7 antibody, Haus7 antibody

Background: This gene encodes a protein identified by interaction with ubiquitin C-terminal hydrolase 37, which functions to edit polyubiquitin chains on ubiquitinated substrates. This protein is a subunit of the multisubunit augmin complex, which regulates centrosom

Molecular Weight: 47 kDa (MW of target protein)