COPG antibody (N-Term)

Catalog No. ABIN632383

Product Details anti-COPG Antibody

Target: COPG (Coatomer Protein Complex, Subunit gamma (COPG))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This COPG antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: COPG antibody was raised against the N terminal of COPG

Purification: Affinity purified

Immunogen: COPG antibody was raised using the N terminal of COPG corresponding to a region with amino acids MLKKFDKKDEESGGGSNPFQHLEKSAVLQEARVFNETPINPRKCAHILTK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

COPG Blocking Peptide, catalog no. 33R-6190, is also available for use as a blocking control in assays to test for specificity of this COPG antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COPG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for COPG

Target: COPG (Coatomer Protein Complex, Subunit gamma (COPG))

Alternative Name: COPG (COPG Products)

Synonyms: COPG antibody, COPG2 antibody, AU019265 antibody, BC056168 antibody, Copg antibody, D6Ertd71e antibody, D6Wsu16e antibody, copg1 antibody, MGC76032 antibody, MGC68533 antibody, COPG1 antibody, coatomer protein complex subunit gamma 1 antibody, coatomer protein complex, subunit gamma 1 antibody, coatomer protein complex subunit gamma 1 L homeolog antibody, coatomer subunit gamma-1 antibody, COPG1 antibody, Copg1 antibody, copg1 antibody, copg1.L antibody, LOC100050080 antibody

Background: The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network.

Molecular Weight: 98 kDa (MW of target protein)