NECAP2 antibody (N-Term)

Catalog No. ABIN632387

Product Details anti-NECAP2 Antibody

Target: NECAP2 (NECAP Endocytosis Associated 2 (NECAP2))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NECAP2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NECAP2 antibody was raised against the N terminal of NECAP2

Purification: Affinity purified

Immunogen: NECAP2 antibody was raised using the N terminal of NECAP2 corresponding to a region with amino acids WQLDQPSWSGRLRITAKGQMAYIKLEDRTSGELFAQAPVDQFPGTAVESV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NECAP2 Blocking Peptide, catalog no. 33R-9994, is also available for use as a blocking control in assays to test for specificity of this NECAP2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NECAP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NECAP2

Target: NECAP2 (NECAP Endocytosis Associated 2 (NECAP2))

Alternative Name: NECAP2 (NECAP2 Products)

Synonyms: MGC83534 antibody, 1110005F07Rik antibody, AA409105 antibody, C78898 antibody, NECAP endocytosis associated 2 antibody, NECAP endocytosis associated 2 L homeolog antibody, NECAP2 antibody, necap2.L antibody, necap2 antibody, Necap2 antibody

Background: This gene likely encodes a member of the adaptin-ear-binding coat-associated protein family. Studies of a similar protein in rat suggest a role in clathrin-mediated endocytosis. Alternatively spliced transcript variants have been described.

Molecular Weight: 28 kDa (MW of target protein)