PPIH antibody

Catalog No. ABIN632394

Product Details anti-PPIH Antibody

Target: PPIH (Peptidylprolyl Isomerase H (Cyclophilin H) (PPIH))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PPIH antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: PPIH antibody was raised using a synthetic peptide corresponding to a region with amino acids VVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PPIH Blocking Peptide, catalog no. 33R-9889, is also available for use as a blocking control in assays to test for specificity of this PPIH antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPIH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PPIH

Target: PPIH (Peptidylprolyl Isomerase H (Cyclophilin H) (PPIH))

Alternative Name: PPIH (PPIH Products)

Synonyms: CYP-20 antibody, CYPH antibody, SnuCyp-20 antibody, USA-CYP antibody, RGD1564921 antibody, cyp-20 antibody, cyph antibody, snucyp-20 antibody, usa-cyp antibody, PPIH antibody, zgc:136730 antibody, zgc:158595 antibody, zgc:55766 antibody, zgc:86780 antibody, 1100001J08Rik antibody, 2010111B15Rik antibody, 4833408F11Rik antibody, AI464484 antibody, D4Wsu43e antibody, peptidylprolyl isomerase H antibody, peptidylprolyl isomerase H (cyclophilin H) antibody, peptidylprolyl isomerase H L homeolog antibody, peptidyl prolyl isomerase H antibody, PPIH antibody, Ppih antibody, ppih antibody, ppih.L antibody

Background: The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is a specific component of the complex that includes pre-mRNA processing factors PRPF3, PRPF4, and PRPF18, as well as U4/U5/U6 tri-snRNP. This protein has been shown to possess PPIase activity and may act as a protein chaperone that mediates the interactions between different proteins inside the spliceosome.

Molecular Weight: 19 kDa (MW of target protein)