C3orf24 antibody (Middle Region)

Catalog No. ABIN632460

Product Details anti-C3orf24 Antibody

Target: C3orf24 (Chromosome 3 Open Reading Frame 24 (C3orf24))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C3orf24 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C3 ORF24 antibody was raised against the middle region of C3 rf24

Purification: Affinity purified

Immunogen: C3 ORF24 antibody was raised using the middle region of C3 rf24 corresponding to a region with amino acids KLPCHTSELRTMNNKGLVRKPQPIRLSGVDSVFGRVITAQPPKWTGTFRV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C3ORF24 Blocking Peptide, catalog no. 33R-4525, is also available for use as a blocking control in assays to test for specificity of this C3ORF24 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF24 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C3orf24

Target: C3orf24 (Chromosome 3 Open Reading Frame 24 (C3orf24))

Alternative Name: C3ORF24 (C3orf24 Products)

Synonyms: C3orf24 antibody, RGD1565997 antibody, FANCD2 opposite strand L homeolog antibody, FANCD2 opposite strand antibody, fancd2os.L antibody, FANCD2OS antibody, fancd2os antibody, Fancd2os antibody

Background: The function of Chromosome 3 ORF protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 20 kDa (MW of target protein)