Actin-Like 6B antibody (Middle Region)

Catalog No. ABIN632472

Product Details anti-Actin-Like 6B Antibody

Target: Actin-Like 6B (ACTL6B)

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Actin-Like 6B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ACTL6 B antibody was raised against the middle region of ACTL6

Purification: Affinity purified

Immunogen: ACTL6 B antibody was raised using the middle region of ACTL6 corresponding to a region with amino acids GHVVTTSIGMCDIDIRPGLYGSVIVTGGNTLLQGFTDRLNRELSQKTPPS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACTL6B Blocking Peptide, catalog no. 33R-3319, is also available for use as a blocking control in assays to test for specificity of this ACTL6B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTL0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Actin-Like 6B

Target: Actin-Like 6B (ACTL6B)

Alternative Name: ACTL6B (ACTL6B Products)

Synonyms: MGC110167 antibody, zgc:110167 antibody, ACTL6 antibody, BAF53B antibody, Actl6 antibody, ArpNa antibody, Baf53b antibody, actin-like 6B antibody, actin like 6B antibody, actl6b antibody, ACTL6B antibody, Actl6b antibody

Background: The protein encoded by this gene is a member of a family of actin-related proteins (ARPs) which share significant amino acid sequence identity to conventional actins.

Molecular Weight: 47 kDa (MW of target protein)