ARL13B antibody (Middle Region)
-
- Target See all ARL13B Antibodies
- ARL13B (ADP-Ribosylation Factor-Like 13B (ARL13B))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ARL13B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ARL13 B antibody was raised against the middle region of ARL13
- Purification
- Affinity purified
- Immunogen
- ARL13 B antibody was raised using the middle region of ARL13 corresponding to a region with amino acids RVEPLNIDDCAPESPTPPPPPPPVGWGTPKVTRLPKLEPLGETHHNDFYR
- Top Product
- Discover our top product ARL13B Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ARL13B Blocking Peptide, catalog no. 33R-8244, is also available for use as a blocking control in assays to test for specificity of this ARL13B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARL10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ARL13B (ADP-Ribosylation Factor-Like 13B (ARL13B))
- Alternative Name
- ARL13B (ARL13B Products)
- Synonyms
- ARL2L1 antibody, MGC185757 antibody, arl2l1 antibody, chunp6872 antibody, fc23g07 antibody, wu:fc23g07 antibody, zgc:123149 antibody, JBTS8 antibody, A530097K21Rik antibody, A930014M17Rik antibody, Arl2l1 antibody, C530009C10Rik antibody, hnn antibody, ADP-ribosylation factor like GTPase 13B antibody, ADP ribosylation factor like GTPase 13B antibody, ADP-ribosylation factor-like 13b antibody, ADP-ribosylation factor-like 13B antibody, Arl13b antibody, ARL13B antibody, arl13b antibody
- Background
- ARL13B has an evolutionarily conserved role mediating cilia function in multiple organs. N and C domains of ARL13B cooperatively regulate its ciliary localization and that N domain-dependent self-association of Arl13b may be important for its function in cilia biogenesis.
- Molecular Weight
- 37 kDa (MW of target protein)
-