PNRC2 antibody (Middle Region)

Catalog No. ABIN632558

Product Details anti-PNRC2 Antibody

Target: PNRC2 (Proline Rich Nuclear Receptor Coactivator 2 (PNRC2))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PNRC2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PNRC2 antibody was raised against the middle region of PNRC2

Purification: Affinity purified

Immunogen: PNRC2 antibody was raised using the middle region of PNRC2 corresponding to a region with amino acids NQSWNSSLSGPRLLFKSQANQNYAGAKFSEPPSPSVLPKPPSHWVPVSFN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PNRC2 Blocking Peptide, catalog no. 33R-6847, is also available for use as a blocking control in assays to test for specificity of this PNRC2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNRC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PNRC2

Target: PNRC2 (Proline Rich Nuclear Receptor Coactivator 2 (PNRC2))

Alternative Name: PNRC2 (PNRC2 Products)

Synonyms: 0610011E17Rik antibody, D4Bwg0593e antibody, wu:cegs2777 antibody, wu:fb51a04 antibody, wu:fb81a06 antibody, wu:fd19g06 antibody, proline rich nuclear receptor coactivator 2 antibody, proline-rich nuclear receptor coactivator 2 antibody, PNRC2 antibody, Pnrc2 antibody, pnrc2 antibody

Background: PNRC2 is involved in nonsense-mediated mRNA decay (NMD) by acting as a bridge between the mRNA decapping complex and the NMD machinery.PNRC2 may act by targeting the NMD machinery to the P-body and recruiting the decapping machinery to aberrant mRNAs. PNRC2 is required for UPF1/RENT1 localization to the P-body. PNRC2 also acts as a nuclear receptor coactivator. PNRC2 may play a role in controlling the energy balance between energy storage and energy expenditure.

Molecular Weight: 15 kDa (MW of target protein)