MTMR14 antibody (Middle Region)
-
- Target See all MTMR14 Antibodies
- MTMR14 (Myotubularin Related Protein 14 (MTMR14))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MTMR14 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MTMR14 antibody was raised against the middle region of MTMR14
- Purification
- Affinity purified
- Immunogen
- MTMR14 antibody was raised using the middle region of MTMR14 corresponding to a region with amino acids NFLKHITSEEFSALKTQRRKSLPARDGGFTLEDICMLRRKDRGSTTSLGS
- Top Product
- Discover our top product MTMR14 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MTMR14 Blocking Peptide, catalog no. 33R-6688, is also available for use as a blocking control in assays to test for specificity of this MTMR14 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTMR14 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MTMR14 (Myotubularin Related Protein 14 (MTMR14))
- Alternative Name
- MTMR14 (MTMR14 Products)
- Synonyms
- fc14d11 antibody, wu:fc14d11 antibody, MGC131146 antibody, C3orf29 antibody, 1110061O04Rik antibody, AW553738 antibody, C76151 antibody, RGD1304842 antibody, jumpy antibody, myotubularin related protein 14 antibody, myotubularin-related protein 14 antibody, myotubularin related protein 14 S homeolog antibody, mtmr14 antibody, LOC703936 antibody, mtmr14.S antibody, MTMR14 antibody, Mtmr14 antibody
- Background
- This gene encodes a myotubularin-related protein. The encoded protein is a phosphoinositide phosphatase that specifically dephosphorylates phosphatidylinositol 3,5-biphosphate and phosphatidylinositol 3-phosphate. Mutations in this gene are correlated with autosomal dominant centronuclear myopathy. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 18.
- Molecular Weight
- 72 kDa (MW of target protein)
- Pathways
- Inositol Metabolic Process
-