C17orf75 antibody (Middle Region)
-
- Target See all C17orf75 Antibodies
- C17orf75 (Chromosome 17 Open Reading Frame 75 (C17orf75))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This C17orf75 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C17 orf75 antibody was raised against the middle region of C17 rf75
- Purification
- Affinity purified
- Immunogen
- C17 orf75 antibody was raised using the middle region of C17 rf75 corresponding to a region with amino acids KLKAIQDTNNLKRFIRQAEMNHYALFKCYMFLKNCGSGDILLKIVKVEHE
- Top Product
- Discover our top product C17orf75 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C17orf75 Blocking Peptide, catalog no. 33R-4513, is also available for use as a blocking control in assays to test for specificity of this C17orf75 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 rf75 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C17orf75 (Chromosome 17 Open Reading Frame 75 (C17orf75))
- Alternative Name
- C17orf75 (C17orf75 Products)
- Synonyms
- NJMU-R1 antibody, C17orf75 antibody, DKFZp469B234 antibody, chromosome 18 C17orf75 homolog antibody, chromosome 17 open reading frame 75 L homeolog antibody, chromosome 17 open reading frame, human C17orf75 antibody, chromosome 17 open reading frame 75 antibody, RIKEN cDNA 5730455P16 gene antibody, C18H17orf75 antibody, c17orf75.L antibody, C17H17orf75 antibody, C17orf75 antibody, 5730455P16Rik antibody
- Background
- The C17orf75 may have a role in spermatogenesis.
- Molecular Weight
- 44 kDa (MW of target protein)
-