GSTK1 antibody (Middle Region)

Catalog No. ABIN632597

Product Details anti-GSTK1 Antibody

Target: GSTK1 (Glutathione S-Transferase kappa 1 (GSTK1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GSTK1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GSTK1 antibody was raised against the middle region of GSTK1

Purification: Affinity purified

Immunogen: GSTK1 antibody was raised using the middle region of GSTK1 corresponding to a region with amino acids NLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GSTK1 Blocking Peptide, catalog no. 33R-6755, is also available for use as a blocking control in assays to test for specificity of this GSTK1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSTK1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GSTK1

Target: GSTK1 (Glutathione S-Transferase kappa 1 (GSTK1))

Alternative Name: GSTK1 (GSTK1 Products)

Synonyms: gst13-13 antibody, GSTK1 antibody, gstk1 antibody, DKFZp459M1330 antibody, GST antibody, GST 13-13 antibody, GST13 antibody, GST13-13 antibody, GSTK1-1 antibody, hGSTK1 antibody, 0610025I19Rik antibody, AW260476 antibody, DsbA-L antibody, GSTkappa antibody, glutathione S-transferase kappa 1 L homeolog antibody, glutathione S-transferase kappa 1 antibody, Glutathione S-transferase kappa 1 antibody, gstk1.L antibody, GSTK1 antibody, gstk1 antibody, PTRG_07256 antibody, Gstk1 antibody, LOC100350399 antibody

Background: GSTK1 is a member of the kappa class of the glutathione transferase superfamily of enzymes that function in cellular detoxification. GSTK1 is localized to the peroxisome and catalyzes the conjugation of glutathione to a wide range of hydrophobic substates facilitating the removal of these compounds from cells.

Molecular Weight: 25 kDa (MW of target protein)