LHPP antibody (Middle Region)
-
- Target See all LHPP Antibodies
- LHPP (Phospholysine Phosphohistidine Inorganic Pyrophosphate Phosphatase (LHPP))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LHPP antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- LHPP antibody was raised against the middle region of LHPP
- Purification
- Affinity purified
- Immunogen
- LHPP antibody was raised using the middle region of LHPP corresponding to a region with amino acids ACGIKAEVVGKPSPEFFKSALQAIGVEAHQAVMIGDDIVGDVGGAQRCGM
- Top Product
- Discover our top product LHPP Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LHPP Blocking Peptide, catalog no. 33R-1067, is also available for use as a blocking control in assays to test for specificity of this LHPP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LHPP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LHPP (Phospholysine Phosphohistidine Inorganic Pyrophosphate Phosphatase (LHPP))
- Alternative Name
- LHPP (LHPP Products)
- Synonyms
- HDHD2B antibody, 2310007H09Rik antibody, zgc:165670 antibody, phospholysine phosphohistidine inorganic pyrophosphate phosphatase antibody, haloacid dehalogenase-like hydrolase domain-containing protein 2 antibody, phospholysine phosphohistidine inorganic pyrophosphate phosphatase S homeolog antibody, LHPP antibody, LB_102 antibody, PSPPH_2719 antibody, LOC5569494 antibody, CpipJ_CPIJ005727 antibody, Lhpp antibody, lhpp.S antibody, lhpp antibody
- Background
- The function of LHPP protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 29 kDa (MW of target protein)
-