TINAGL1 antibody (Middle Region)
-
- Target See all TINAGL1 Antibodies
- TINAGL1 (Tubulointerstitial Nephritis Antigen-Like 1 (TINAGL1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TINAGL1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TINAGL1 antibody was raised against the middle region of TINAGL1
- Purification
- Affinity purified
- Immunogen
- TINAGL1 antibody was raised using the middle region of TINAGL1 corresponding to a region with amino acids NLIHEPLDQGNCAGSWAFSTAAVASDRVSIHSLGHMTPVLSPQNLLSCDT
- Top Product
- Discover our top product TINAGL1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TINAGL1 Blocking Peptide, catalog no. 33R-6759, is also available for use as a blocking control in assays to test for specificity of this TINAGL1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TINAGL1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TINAGL1 (Tubulointerstitial Nephritis Antigen-Like 1 (TINAGL1))
- Alternative Name
- TINAGL1 (TINAGL1 Products)
- Synonyms
- ARG1 antibody, LCN7 antibody, LIECG3 antibody, TINAGRP antibody, 1110021J17Rik antibody, AZ-1 antibody, AZ1 antibody, Arg1 antibody, Lcn7 antibody, TARP antibody, Tinagl antibody, gis5 antibody, tubulointerstitial nephritis antigen like 1 antibody, tubulointerstitial nephritis antigen-like 1 antibody, TINAGL1 antibody, Tinagl1 antibody
- Background
- TINAGL1 may be implicated in the adrenocortical zonation and in mechanisms for repressing the CYP11B1 gene expression in adrenocortical cells. This is a non catalytic peptidase C1 family protein.
- Molecular Weight
- 52 kDa (MW of target protein)
-